PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10011169m
Common NameCICLE_v10011169mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 728aa    MW: 78218.6 Da    PI: 7.1278
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10011169mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-14219281163
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      e+e kr  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +   +L ++++    e a+lk+++
  Ciclev10011169m 219 EEEMKRKARLMRNRESAQLSRQRKKHYVEELEDKVRNMHSTIADLNSKISFFMAENASLKQQL 281
                      789*********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-16219283IPR004827Basic-leucine zipper domain
PfamPF001706.2E-13219281IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.174221281IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-12222281No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-18223282No hitNo description
CDDcd147048.60E-22224275No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MSDPLLAEAP PPSNDFDALS IPPLDPPYLN SQIPHPCASS DDLDFFLDDN CDFDFTIDDL  60
YFASEDDTFF LPSEDPQDGE FGGFSPGVDG GAAAASPGSG SSGILGNPAS LDVESYLNYS  120
SSPQNSGNRI SHLNSIGISG GRSENSGSGV SSDNTDAPSP DSGNLVVDQK IKMEEVSKKG  180
IFKRKKDIEE TNNESRSNKY RKSSSLSVNE ADNDHNLGEE EMKRKARLMR NRESAQLSRQ  240
RKKHYVEELE DKVRNMHSTI ADLNSKISFF MAENASLKQQ LSGSNAMPPP LGMYPPPPHM  300
AAAPMPYGWM PCAAPYMVKP QGSQVPLVPI PRLKPQAAAA AVPSRTKKSD GNKSKSDGSK  360
TKKVASVSFL GLLFFILLFG GLVPLVDVKY GGIRDGVSGG HFGSGFYNQH RGRVLTINGY  420
SNGSGESMGI GFPNGRVGFD NRIHCARAVE SKEKESQPAP DSDEFVRPRN ASEPLVASLY  480
VPRNDKLVKI DGNLIIHSVL ASEKAMASHD ASKANSKEAT GLAIPKDFSP ALAIPDVRGN  540
GARHSHFYRN PAERQRAISS GSTDALKDHM KSSAANGKLQ QWFQEGLSGP LLSSGMCTEV  600
FQFDASPAPG AIIPASSVAN MTAEHRQNAT QVNRGRNRRI LHRLPVPLTN FTGERKAQKE  660
SFAGNKSASS MVVSVLVDPR ETGDGDVEGM ISPKSLSRIF VVVLLDSVKY VTYSCGLPRS  720
GLHLVTS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1625638RQNATQVNRGRNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430509.10.0hypothetical protein CICLE_v10011169mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4UVN20.0V4UVN2_9R
STRINGVIT_08s0040g00870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-176bZIP family protein